Companies in Canada with 11–50 employees. Page 119
Browse company profiles in Canada with 11–50 employees, with their industries, email formats and decision-maker contacts.
2,459company profiles
2,459 company profiles in Canada with 11–50 employees
| Company | Industry | Location | Employees | Emails found |
|---|---|---|---|---|
SRSA Commercial Real Estatesrsa-realestate.com
SRSA Commercial Real Estate is a Commercial Brokerage Services company. Their team is based in Metairie, Louisiana. The company specializes…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
Spinoso Real Estate Groupspinosoreg.com
Spinoso Real Estate Group is a Commercial Brokerage Services company. In Syracuse, New York, their team specializes in Commercial Brokerage…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
AVSA Grupo Inmobiliarioavsa.cl
Established in 1992, AVSA Grupo Inmobiliario is a Commercial Brokerage Services company. Their services include Commercial Brokerage…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
xyzxyz
Xyz is a Commercial Property Management company. Their small team is headquartered in xyz, California. Their team offers Commercial…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
Cooke & Arkwrightcoark.com
Launched in 1900, Cooke & Arkwright is a Commercial Brokerage Services company. The team provides Commercial Brokerage Services and…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
NAI Partnersnaipartners.com
Midsize Commercial Brokerage Services company NAI Partners, is in Houston, Texas. The team offers Commercial Brokerage Services and…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
Big Trash Panda Junk Removalbigtrashpanda.com
Big Trash Panda Junk Removal is a Commercial Property Management company launched in 2022. The company focuses on Commercial Property…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
NTB Associates, Inc.ntbainc.com
Commercial Development company NTB Associates, Inc. Is based in Shreveport, Louisiana. The team focuses on Commercial Development and…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
Winthrop Workspacewinthropworkspace.com
Winthrop Workspace is a small Winthrop, Maine-based Commercial Property Management company. Their services include Commercial Property…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
Stahly Engineering & Associatesseaeng.com
Commercial Development company Stahly Engineering & Associates was established in 1970. The team specializes in Commercial Development and…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
Robert Peccia & Associatesrpa-eng.com
Robert Peccia & Associates is a midsize Commercial Development company. They focus on Commercial Development and Engineering and were…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
Air Duct Cleaning LLCaffordableairductcleaningllc.com
Air Duct Cleaning LLC is a Commercial Property Management company. Established in 2023, their team specializes in Commercial Property…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
The Powerwash Manthepowerwashman.ie
Launched in 2018, The Powerwash Man is a small Dublin, Ireland-based Commercial Property Management company. Their services include…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
Selling South Winnipeg - Kyle Bazylo - Realtorsellingsouthwinnipeg.ca
Selling South Winnipeg - Kyle Bazylo - Realtor, a Commercial Property Management company, was founded in 2021. The agency provides…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
RMR Groupiloveactive.com
RMR Group is a small Commercial Development company. Founded in 2004, the team provides Commercial Development.
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
|
ONTIME Chimney Sweep & Repair Servicesontimechimneysweeprepairservices.xyz
ONTIME Chimney Sweep & Repair Services is a small Commercial Property Management company based in Kirkland, Washington. The team…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
Crisp Cleaning LLCcrispcleaningca.com
Launched in 2022, Crisp Cleaning LLC is a Commercial Property Management company. The small team offers Commercial Property Management.
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
Rajali Promotersrajalipromoters.com
Commercial Property Management and Engineering company Rajali Promoters offers Commercial Property Management and Engineering. They are…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
Rain City Moving Cleanersvancouverclean.ca
Rain City Moving Cleaners is a Commercial Property Management company launched in 2023. The team provides Commercial Property Management.
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
ZenithRoofs Realtyphilomathwoman.com
Established in 2020, ZenithRoofs Realty is a Commercial Property Management company. The team focuses on Commercial Property Management and…
|
Technology & Software | Edmonton, Canada | 50 - 249 | 0 |
Questions about companies in Canada with 11–50 employees
How many companies are listed?
2,459 companies in Canada with 11–50 employees have a public profile you can browse here.
How do I find the right contact at a company?
Open a company profile to see its contacts by team and its most common email format.
Related
About this data
Only organizations with a business domain are listed. Consumer mail providers such as Gmail or Yahoo are not shown as company contacts.